PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT11879
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 395aa    MW: 42145 Da    PI: 7.2587
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT11879genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.58e-51111391128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
               +ppGfrFhPt+eel+++yL kkv++++++l +vi++vd++k+ePwd+++  ++ +  +++wy Fs++dkky+tg+r+nrat++g+Wkatg+dk+++s    
  EMT11879  11 VPPGFRFHPTEEELLTYYLSKKVASQRIDL-DVIPDVDLNKLEPWDIQArcRIGTgPQNDWYLFSHKDKKYPTGTRTNRATAAGFWKATGRDKPIYS-AAG 109
               69****************************.9***************953444443456**************************************.777 PP

       NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +g++ktLvfykgrap+g+k+dW+mheyrl
  EMT11879 110 RIGMRKTLVFYKGRAPHGHKSDWIMHEYRL 139
               8***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.24E-557149IPR003441NAC domain
PROSITE profilePS5100553.67911191IPR003441NAC domain
PfamPF023652.2E-2612139IPR003441NAC domain
SuperFamilySSF1019418.24E-55179191IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MSISVNGQSV VPPGFRFHPT EEELLTYYLS KKVASQRIDL DVIPDVDLNK LEPWDIQARC  60
RIGTGPQNDW YLFSHKDKKY PTGTRTNRAT AAGFWKATGR DKPIYSAAGR IGMRKTLVFY  120
KGRAPHGHKS DWIMHEYRLD DAVAPATNTV FAAGDASSYY SGISSPVRGV AGDQSPLAQE  180
DGWVICRVFK KNIVAQHQAG QSGGRGGGAA SNKLVGAGAV ERSQSNCSST VTAASDPAKA  240
QMMHCAGSDD GLDNILRYMD RSSAASCKQE TKPTNPSSSP LDQLINSACH SGSSTLYEKF  300
MKLPPLEYGG DWDALDRLAA YELNGLSDAA TAKTTNGMSY IVDELGGATT AYTSGGTAHS  360
SSLTGGGDGD LWSLARSVSS LHADLTMTCF NAVGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-451113915140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3678010.0AK367801.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2062J03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655752.11e-148PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-100NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM8BYI00.0M8BYI0_AEGTA; NAC domain-containing protein 43
STRINGMLOC_75524.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.13e-88NAC family protein